Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GID8 Peptide - C-terminal region

GID8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TWA1, C20orf11

UniProt

Q9NWU2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060366.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Mouse Neuronal Pentraxin I (NPTX1) ELISA
KLM6019 1x 96 Well

GENLISA™ Mouse Neuronal Pentraxin I (NPTX1) ELISA

Sign In for Pricing
View Details
PTHLH Recombinant Protein (Human)
OPCA03932-100UG 100 µg

PTHLH Recombinant Protein (Human)

Sign In for Pricing
View Details
C18orf51 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
14038111 3x 1.0 µg

C18orf51 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SIGLEC9 3'UTR GFP Stable Cell Line
TU073180 1.0 mL

SIGLEC9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-DNA Polymerase beta Antibody
MBS4512051-01 0.05 mL

Rabbit anti-DNA Polymerase beta Antibody

Sign In for Pricing
View Details
Rabbit anti-DNA Polymerase beta Antibody
MBS4512051-02 0.1 mL

Rabbit anti-DNA Polymerase beta Antibody

Sign In for Pricing
View Details