What is the catalog number for LRIF1 Peptide - middle region?

The catalog number for LRIF1 Peptide - middle region is orb1998836.

What sizes are available for LRIF1 Peptide - middle region?

LRIF1 Peptide - middle region is available in the following size(s): 100 µg.

Is LRIF1 Peptide - middle region in stock?

LRIF1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

LRIF1 Peptide - middle region

Product Specifications

Product Name Alternative

RIF1, HBiX1, C1orf103

UniProt

Q5T3J3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001006946.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGRNDKKDSQGRSNKALHLKSDAEFKKIFGLTKDLRVCLTRIPDHLTSGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

abx506672 96 Tests

Rat Carbohydrate Sulfotransferase 3 (CHST3) ELISA Kit

Sign In for Pricing

View Details

NBP3-14131AF488 0.1 mL

Mouse Monoclonal Zinc finger protein 639 Antibody (PCRP-ZNF639-2B2) [Alexa Fluor 488]

Sign In for Pricing

View Details

LC415658 20 µg

PKN beta (PKN3) (NM_013355) Human Over-expression Lysate

Sign In for Pricing

View Details

GTR15387254 1 Vial

Lentiviral human JCHAIN sgRNA gene knockout kit - Lentiviral human JCHAIN sgRNA gene knockout kit (plasmid)

Sign In for Pricing

View Details

DNM-SP23-011 5 mL

DiagPoly™ Protein G Polystyrene Particles, 4.0-4.9 μm

Sign In for Pricing

View Details

C07232-25mg 25 mg

ADH-503 (GB1275)

Sign In for Pricing

View Details