Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRIF1 Peptide - middle region

LRIF1 Peptide - middle region

Product Specifications

Product Name Alternative

RIF1, HBiX1, C1orf103

UniProt

Q5T3J3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001006946.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGRNDKKDSQGRSNKALHLKSDAEFKKIFGLTKDLRVCLTRIPDHLTSGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Octadecanoic-18,18,18-d3 Acid
TRC-S686499-5MG 5 mg

Octadecanoic-18,18,18-d3 Acid

Sign In for Pricing
View Details
Recombinant Human MR1 Protein, C-Avi
bs-104938P-01 20 µg

Recombinant Human MR1 Protein, C-Avi

Sign In for Pricing
View Details
Recombinant Human MR1 Protein, C-Avi
bs-104938P-02 50 µg

Recombinant Human MR1 Protein, C-Avi

Sign In for Pricing
View Details
Goat anti-Mouse IgG2a Cross-Adsorbed Antibody Affinity Purified
A90-207A 0.5 mg

Goat anti-Mouse IgG2a Cross-Adsorbed Antibody Affinity Purified

Sign In for Pricing
View Details
PDZRN4 (NM_013377) Human Recombinant Protein
PH31525E1 50 µg

PDZRN4 (NM_013377) Human Recombinant Protein

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to 2', 3'-Cyclic Nucleotide 3'-Phosphodiesterase (CNP)
MBS2064433-01 0.1 mL

FITC-Linked Polyclonal Antibody to 2', 3'-Cyclic Nucleotide 3'-Phosphodiesterase (CNP)

Sign In for Pricing
View Details