Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMD Peptide - middle region

EMD Peptide - middle region

Product Specifications

Product Name Alternative

STA, EDMD, LEMD5

UniProt

P50402

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000108.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSSSAASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYF

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAN2A1 CRISPR Activation Plasmid (h)
sc-408136-ACT 20 µg

MAN2A1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
MAP1LC3C, NT (APG8C) (LC3, MAP1LC3C, Microtubule-associated proteins 1A/1B light chain 3C, Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, MAP1 light chain 3-like protein 3, MAP1A/MAP1B light chain 3 C, Microtubule-associated protein 1 light chain 3 gamma) (MaxLight 750) discontinued
038119-ML750 100 µL

MAP1LC3C, NT (APG8C) (LC3, MAP1LC3C, Microtubule-associated proteins 1A/1B light chain 3C, Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, MAP1 light chain 3-like protein 3, MAP1A/MAP1B light chain 3 C, Microtubule-associated protein 1 light chain 3 gamma) (MaxLight 750) discontinued

Sign In for Pricing
View Details
LINC00446 Adenovirus (Human)
26757051 1.0 mL

LINC00446 Adenovirus (Human)

Sign In for Pricing
View Details
ANO7 Antibody (N-term)
orb1927925-01 50 µL

ANO7 Antibody (N-term)

Sign In for Pricing
View Details
ANO7 Antibody (N-term)
orb1927925-02 100 µL

ANO7 Antibody (N-term)

Sign In for Pricing
View Details
Sheep Alanine glyoxylate aminotransferase 2 like 2 (AGXT2L2) ELISA Kit
GTR10335025 96 Well

Sheep Alanine glyoxylate aminotransferase 2 like 2 (AGXT2L2) ELISA Kit

Sign In for Pricing
View Details