Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMD Peptide - middle region

EMD Peptide - middle region

Product Specifications

Product Name Alternative

STA, EDMD, LEMD5

UniProt

P50402

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000108.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSSSAASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYF

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS12 antibody
OAGA00845-100UL 100 µL

BBS12 antibody

Sign In for Pricing
View Details
KLHL2 antibody - middle region
MBS3210723-01 0.1 mL

KLHL2 antibody - middle region

Sign In for Pricing
View Details
KLHL2 antibody - middle region
MBS3210723-02 5x 0.1 mL

KLHL2 antibody - middle region

Sign In for Pricing
View Details
Phf7 (NM_001012211) Rat Tagged ORF Clone Lentiviral Particle
RR213035L3V 200 µL

Phf7 (NM_001012211) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PDX1 Antibody / Pancreatic and duodenal homeobox 1
FY13210 100 µg

PDX1 Antibody / Pancreatic and duodenal homeobox 1

Sign In for Pricing
View Details
ATN1 Protein Vector (Rat) (pPM-C-HA)
12651026 500 ng

ATN1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details