Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYN Peptide - middle region

LYN Peptide - middle region

Product Specifications

Product Name Alternative

JTK8, p53Lyn, p56Lyn

UniProt

P07948

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001104567.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGCS1 Protein Vector (Rat) (pPB-C-His)
PV272990 500 ng

HMGCS1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
JNK3/MAPK10 Rabbit Polyclonal Antibody (Cy7)
orb1047910 100 µL

JNK3/MAPK10 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
HOXC8 (Homeobox Protein Hox-C8, Homeobox Protein Hox-3A, HOX3A) (FITC)
128039-FITC 100 µL

HOXC8 (Homeobox Protein Hox-C8, Homeobox Protein Hox-3A, HOX3A) (FITC)

Sign In for Pricing
View Details
Resiquimod discontinued. See 207380
R1584-25 5 mg

Resiquimod discontinued. See 207380

Sign In for Pricing
View Details
Methyl 5-chloro-2-nitrobenzoate
455699-01 100 mg

Methyl 5-chloro-2-nitrobenzoate

Sign In for Pricing
View Details
Methyl 5-chloro-2-nitrobenzoate
455699-02 250 mg

Methyl 5-chloro-2-nitrobenzoate

Sign In for Pricing
View Details