Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBX1 Peptide - middle region

PBX1 Peptide - middle region

Product Specifications

UniProt

P40424

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191892.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat TRIM55 shRNA Plasmid
abx990638-01 150 µg

Rat TRIM55 shRNA Plasmid

Sign In for Pricing
View Details
Rat TRIM55 shRNA Plasmid
abx990638-02 300 µg

Rat TRIM55 shRNA Plasmid

Sign In for Pricing
View Details
AQP1 antibody
70R-51451 100 ul

AQP1 antibody

Sign In for Pricing
View Details
2-Bromoethylcyclopropane
TRC-B686035-250MG 250 mg

2-Bromoethylcyclopropane

Sign In for Pricing
View Details
PDE1A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV668890 1.0 µg DNA

PDE1A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
RNF40 Human shRNA Lentiviral Particle (Locus ID 9810)
TL316882V 500 µL Each

RNF40 Human shRNA Lentiviral Particle (Locus ID 9810)

Sign In for Pricing
View Details