What is the catalog number for PBX1 Peptide - middle region?

The catalog number for PBX1 Peptide - middle region is orb1998828.

What sizes are available for PBX1 Peptide - middle region?

PBX1 Peptide - middle region is available in the following size(s): 100 µg.

Is PBX1 Peptide - middle region in stock?

PBX1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PBX1 Peptide - middle region

Product Specifications

UniProt

P40424

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191892.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-14266H 0.1 mL

Mouse Monoclonal CNOT10 Antibody (PCRP-CNOT10-1D5) [HRP]

Sign In for Pricing

View Details

57704151 3x 1.0 µg DNA

FTHL19 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing

View Details

E20-70135 100 µg

ADK Polyclonal Antibody

Sign In for Pricing

View Details

orb327398 100 µL

TSEN34 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

LS001431 100 µg

Citrate synthetase (CS) (NM_004077) Human Over-expression Lysate

Sign In for Pricing

View Details

TU169703 1.0 mL

Srpx2 3'UTR GFP Stable Cell Line

Sign In for Pricing

View Details