Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAB1 Peptide - middle region

DAB1 Peptide - middle region

Product Specifications

UniProt

O75553

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066566.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFIIA-γ (D-6) PE
sc-374483 PE 200 µg/mL

TFIIA-γ (D-6) PE

Sign In for Pricing
View Details
Human UBE2K Recombinant Protein N-GST Tag 50UG
IHUUBE2KRNGST50UG 50 µg

Human UBE2K Recombinant Protein N-GST Tag 50UG

Sign In for Pricing
View Details
LTC4S Polyclonal Antibody
E915071 100 µL

LTC4S Polyclonal Antibody

Sign In for Pricing
View Details
MAGEB18 Antibody
orb1336480 100 µg

MAGEB18 Antibody

Sign In for Pricing
View Details
Tmem169 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6542807 1.0 µg DNA

Tmem169 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human ADAMTS3 Protein
E30P12178 20 µg

Recombinant Human ADAMTS3 Protein

Sign In for Pricing
View Details