DAB1 Peptide - middle region
DAB1 Peptide - middle region
Product Specifications
UniProt
O75553
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_066566.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SZ101 3 mL
Salmonella Antiserum/Surowica Salmonella anty H:z13 - 3ml
Sign In for Pricing
View Details 
orb2901888-01 20 µg
Recombinant Human 5-hydroxytryptamine receptor 2C (HTR2C)
Sign In for Pricing
View Details orb2901888-02 100 µg
Recombinant Human 5-hydroxytryptamine receptor 2C (HTR2C)
Sign In for Pricing
View Details 
