Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFITM3 Peptide - N-terminal region

IFITM3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1-8U, IP15, DSPA2b

UniProt

Q01628

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066362.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF3A3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43564061 1.0 µg DNA

SF3A3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-Human ERBB4/Her4 Antibody (mAb1479), APC
FHH06113 100 Tests

Anti-Human ERBB4/Her4 Antibody (mAb1479), APC

Sign In for Pricing
View Details
Histone H2A, phosphorylated (Thr121) discontinued
537253-01 30ul

Histone H2A, phosphorylated (Thr121) discontinued

Sign In for Pricing
View Details
Histone H2A, phosphorylated (Thr121) discontinued
537253-02 100 µL

Histone H2A, phosphorylated (Thr121) discontinued

Sign In for Pricing
View Details
SOD2 Recombinant Protein
OPCD07109-50UG 50 µg

SOD2 Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Mammaglobin A Antibody (SPM518)
NBP2-79729-20ug 20 µg

Mouse Monoclonal Mammaglobin A Antibody (SPM518)

Sign In for Pricing
View Details