ABI2 Peptide - middle region
ABI2 Peptide - middle region
Product Specifications
Product Name Alternative
ABI-2, ABI2B, AIP-1, AblBP3, argBP1, SSH3BP2, argBPIA, argBPIB
UniProt
Q9NYB9
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001269854.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9422934-01 0.005 mg
Recombinant Mouse C-C motif chemokine 8 protein (Ccl8)
Sign In for Pricing
View Details MBS9422934-02 0.02 mg
Recombinant Mouse C-C motif chemokine 8 protein (Ccl8)
Sign In for Pricing
View Details MBS9422934-03 0.1 mg
Recombinant Mouse C-C motif chemokine 8 protein (Ccl8)
Sign In for Pricing
View Details MBS9422934-04 0.25 mg
Recombinant Mouse C-C motif chemokine 8 protein (Ccl8)
Sign In for Pricing
View Details MBS9422934-05 0.5 mg
Recombinant Mouse C-C motif chemokine 8 protein (Ccl8)
Sign In for Pricing
View Details MBS9422934-06 1 mg
Recombinant Mouse C-C motif chemokine 8 protein (Ccl8)
Sign In for Pricing
View Details