Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABI2 Peptide - middle region

ABI2 Peptide - middle region

Product Specifications

Product Name Alternative

ABI-2, ABI2B, AIP-1, AblBP3, argBP1, SSH3BP2, argBPIA, argBPIB

UniProt

Q9NYB9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269854.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp2b1 ORF Vector (Rat) (pORF)
12686016 1.0 µg DNA

Atp2b1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Pig GTPase NRas (NRAS) ELISA Kit
MBS281603-01 48 Tests

Pig GTPase NRas (NRAS) ELISA Kit

Sign In for Pricing
View Details
Pig GTPase NRas (NRAS) ELISA Kit
MBS281603-02 96 Tests

Pig GTPase NRas (NRAS) ELISA Kit

Sign In for Pricing
View Details
Pig GTPase NRas (NRAS) ELISA Kit
MBS281603-03 5x 96 Tests

Pig GTPase NRas (NRAS) ELISA Kit

Sign In for Pricing
View Details
Pig GTPase NRas (NRAS) ELISA Kit
MBS281603-04 10x 96 Tests

Pig GTPase NRas (NRAS) ELISA Kit

Sign In for Pricing
View Details
TBX1 Antibody
E18-0327-2 100 µg -100 µL

TBX1 Antibody

Sign In for Pricing
View Details