Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4A11 Peptide - middle region

CYP4A11 Peptide - middle region

Product Specifications

Product Name Alternative

CP4Y, CYP4A2, CYP4AII

UniProt

Q02928

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000769.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI44 (NM_006417) Human Recombinant Protein
TP305042L 1 mg

IFI44 (NM_006417) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human Trefoil factor 3/TFF3 protein (GST, His tag)
PDEH101073-01 20 µg

Recombinant Human Trefoil factor 3/TFF3 protein (GST, His tag)

Sign In for Pricing
View Details
Recombinant Human Trefoil factor 3/TFF3 protein (GST, His tag)
PDEH101073-02 100 µg

Recombinant Human Trefoil factor 3/TFF3 protein (GST, His tag)

Sign In for Pricing
View Details
Recombinant Human Trefoil factor 3/TFF3 protein (GST, His tag)
PDEH101073-03 500 µg

Recombinant Human Trefoil factor 3/TFF3 protein (GST, His tag)

Sign In for Pricing
View Details
Recombinant Human Trefoil factor 3/TFF3 protein (GST, His tag)
PDEH101073-04 1 mg

Recombinant Human Trefoil factor 3/TFF3 protein (GST, His tag)

Sign In for Pricing
View Details
UQCRH Recombinant Rabbit Monoclonal Antibody [JE62-25]
HA720113 100 µL

UQCRH Recombinant Rabbit Monoclonal Antibody [JE62-25]

Sign In for Pricing
View Details