Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4A11 Peptide - middle region

CYP4A11 Peptide - middle region

Product Specifications

Product Name Alternative

CP4Y, CYP4A2, CYP4AII

UniProt

Q02928

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000769.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lymphoid tissue
CR561350 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
CBL Antibody (Biotin)
KB-1397-01 50 μL

CBL Antibody (Biotin)

Sign In for Pricing
View Details
CBL Antibody (Biotin)
KB-1397-02 100 µL

CBL Antibody (Biotin)

Sign In for Pricing
View Details
CBL Antibody (Biotin)
KB-1397-03 1 mL

CBL Antibody (Biotin)

Sign In for Pricing
View Details
Tissue Total RNA, Colon: transverse
CR560939 5 µg

Tissue Total RNA, Colon: transverse

Sign In for Pricing
View Details
RIZ1 (PRDM2) (NM_001135610) Human Over-expression Lysate
LC427635 20 µg

RIZ1 (PRDM2) (NM_001135610) Human Over-expression Lysate

Sign In for Pricing
View Details