Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC3A1 Peptide - middle region

SLC3A1 Peptide - middle region

Product Specifications

Product Name Alternative

D2H, ATR1, NBAT, RBAT, CSNU1

UniProt

Q07837

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000332.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NIVAANLNESYDINTLRSKSPMQWDNSSNAGFSEASNTWLPTNSDYHTVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Puberulic Acid
TRC-P196705-5MG 5 mg

Puberulic Acid

Sign In for Pricing
View Details
GPATCH8 Human Gene Knockout Kit (CRISPR)
KN419640 1 Kit

GPATCH8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nucleophosmin (NPM1) Rabbit Polyclonal Antibody
AP21057PU-N 100 µg

Nucleophosmin (NPM1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF4A3 (NM_014740) Human Over-expression Lysate
LC402368 20 µg

EIF4A3 (NM_014740) Human Over-expression Lysate

Sign In for Pricing
View Details
Biotin Conjugated Human IFN-alpha Recombinant Rabbit Monoclonal Antibody [PS00-79] - BSA and Azide free (Detector)
HA721369 100 µL

Biotin Conjugated Human IFN-alpha Recombinant Rabbit Monoclonal Antibody [PS00-79] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
PPOX Rabbit Polyclonal Antibody
TA370384 100 µL

PPOX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details