Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPC7 Peptide - middle region

TRPC7 Peptide - middle region

Product Specifications

Product Name Alternative

TRP7

UniProt

Q9HCX4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001161048.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12) SDHB Polyclonal Antibody
MBS7164639 Inquire

Rabbit anti-Escherichia coli (strain K12) SDHB Polyclonal Antibody

Sign In for Pricing
View Details
NAGPA (NM_016256) Human Over-expression Lysate
LS051172 100 µg

NAGPA (NM_016256) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human UHRF1 shRNA (UAS) - Lentiviral human UHRF1 shRNA (UAS, RFP) (100)
GTR15088128 1 Vial

Lentiviral human UHRF1 shRNA (UAS) - Lentiviral human UHRF1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
RAD51AP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1779307 1.0 µg DNA

RAD51AP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
LMO4 Human Over-expression Lysate
orb1377582 20 µg

LMO4 Human Over-expression Lysate

Sign In for Pricing
View Details
Clindamycin-13C, D3
444869-01 500 µg

Clindamycin-13C, D3

Sign In for Pricing
View Details