Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPC7 Peptide - middle region

TRPC7 Peptide - middle region

Product Specifications

Product Name Alternative

TRP7

UniProt

Q9HCX4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001161048.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D1, Antibody
GWB-E16836 7 mL

Cyclin D1, Antibody

Sign In for Pricing
View Details
CCT5 Antibody
MBS7046297-01 0.05 mL

CCT5 Antibody

Sign In for Pricing
View Details
CCT5 Antibody
MBS7046297-02 0.1 mL

CCT5 Antibody

Sign In for Pricing
View Details
CCT5 Antibody
MBS7046297-03 5x 0.1 mL

CCT5 Antibody

Sign In for Pricing
View Details
SLITRK6 Human Monoclonal Antibody (PE)
orb2970430-01 50 Tests

SLITRK6 Human Monoclonal Antibody (PE)

Sign In for Pricing
View Details
SLITRK6 Human Monoclonal Antibody (PE)
orb2970430-02 100 Tests

SLITRK6 Human Monoclonal Antibody (PE)

Sign In for Pricing
View Details