Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB6A Peptide - middle region

RAB6A Peptide - middle region

Product Specifications

Product Name Alternative

RAB6

UniProt

P20340

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230647.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krueppel-Like Factor 1 (KLF1) Antibody (HRP)
abx306967-01 20 µg

Krueppel-Like Factor 1 (KLF1) Antibody (HRP)

Sign In for Pricing
View Details
Krueppel-Like Factor 1 (KLF1) Antibody (HRP)
abx306967-02 50 µg

Krueppel-Like Factor 1 (KLF1) Antibody (HRP)

Sign In for Pricing
View Details
Krueppel-Like Factor 1 (KLF1) Antibody (HRP)
abx306967-03 100 µg

Krueppel-Like Factor 1 (KLF1) Antibody (HRP)

Sign In for Pricing
View Details
Krueppel-Like Factor 1 (KLF1) Antibody (HRP)
abx306967-04 200 µg

Krueppel-Like Factor 1 (KLF1) Antibody (HRP)

Sign In for Pricing
View Details
Krueppel-Like Factor 1 (KLF1) Antibody (HRP)
abx306967-05 1 mg

Krueppel-Like Factor 1 (KLF1) Antibody (HRP)

Sign In for Pricing
View Details
TBX2, ID (TBX2, T-box transcription factor TBX2) (MaxLight 750)
MBS6354181-01 0.1 mL

TBX2, ID (TBX2, T-box transcription factor TBX2) (MaxLight 750)

Sign In for Pricing
View Details