Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB6A Peptide - middle region

RAB6A Peptide - middle region

Product Specifications

Product Name Alternative

RAB6

UniProt

P20340

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230647.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat RBP1 shRNA Plasmid
abx984766-01 150 µg

Rat RBP1 shRNA Plasmid

Sign In for Pricing
View Details
Rat RBP1 shRNA Plasmid
abx984766-02 300 µg

Rat RBP1 shRNA Plasmid

Sign In for Pricing
View Details
TSPEAR (A-10) Alexa Fluor® 594
sc-373868 AF594 200 µg/mL

TSPEAR (A-10) Alexa Fluor® 594

Sign In for Pricing
View Details
Human CCBL1 Antibody (Biotin Conjugate)
32779-05121 150 µg

Human CCBL1 Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
CRS1C-2 siRNA (m)
sc-142582 10 µM

CRS1C-2 siRNA (m)

Sign In for Pricing
View Details
PLCG1, Phosphorylated (Tyr783) (1-phosphatidylinositol 4,5-bisphosphate Phosphodiesterase gamma-1, PLC-148, Phosphoinositide Phospholipase C-gamma-1, Phospholipase C-II, PLC-II, Phospholipase C-gamma-1, PLC-gamma-1, PLC1) (Biotin) discontinued
217676-Biotin 100 µL

PLCG1, Phosphorylated (Tyr783) (1-phosphatidylinositol 4,5-bisphosphate Phosphodiesterase gamma-1, PLC-148, Phosphoinositide Phospholipase C-gamma-1, Phospholipase C-II, PLC-II, Phospholipase C-gamma-1, PLC-gamma-1, PLC1) (Biotin) discontinued

Sign In for Pricing
View Details