STAG2 Peptide - middle region
STAG2 Peptide - middle region
Product Specifications
Product Name Alternative
SA2, SA-2, SCC3B, bA517O1.1
UniProt
Q8N3U4
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001036214.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DDDNNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4308601 3x 1.0 µg
1300018J18Rik sgRNA CRISPR Lentivector set (Mouse)
Sign In for Pricing
View Details 
FM3-FY45G0-25tests 25 Tests
FITC-Labeled Monoclonal Anti-FMC63 Antibody, Mouse IgG1 (Y45), premium grade
Sign In for Pricing
View Details orb3085488 100 µg
Splicing factor 1 Mouse Monoclonal Antibody (Fluoro550)
Sign In for Pricing
View Details 042680-APC 200 µL
TCAL3, NT (TCEAL3, Transcription elongation factor A protein-like 3, Transcription elongation factor S-II protein-like 3) (APC) discontinued
Sign In for Pricing
View Details