STAG2 Peptide - middle region
STAG2 Peptide - middle region
Product Specifications
Product Name Alternative
SA2, SA-2, SCC3B, bA517O1.1
UniProt
Q8N3U4
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001036214.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DDDNNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2903596 Inquire
Human ECE1 / Endothelin-Converting Enzyme 1 Recombinant Protein
Sign In for Pricing
View Details MBS103408 Inquire
Goat Nitric Oxide Synthase Interacting Protein ELISA Kit
Sign In for Pricing
View Details GTR15398456 1 Vial
Lentiviral human SH3PXD2B sgRNA gene knockout kit - Lentiviral human SH3PXD2B sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
152661 96 Tests
C Reactive Protein (CRP) BioAssayTM ELISA Kit (Rat) (High Sensitivity)
Sign In for Pricing
View Details