Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUT7 Peptide - middle region

FUT7 Peptide - middle region

Product Specifications

Product Name Alternative

FucT-VII

UniProt

Q11130

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004470.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGRPLCASCLVPTVAQYRFYLSFENSQHRDYITEKFWRNALVAGTVPVVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRNA7 Protein Vector (Mouse) (pPM-C-HA)
16128024 500 ng

CHRNA7 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GSC2 (NM_005315) Human Tagged ORF Clone Lentiviral Particle
RC218631L3V 200 µL

GSC2 (NM_005315) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TECK (CCL25) (NM_005624) Human Untagged Clone
SC303672 10 µg

TECK (CCL25) (NM_005624) Human Untagged Clone

Sign In for Pricing
View Details
PCNPP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV739793 1.0 µg DNA

PCNPP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Fam109b sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3637503 1.0 µg DNA

Fam109b sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Human Arginase-1/ARG1 Protein, His Tag
E40KMH693 20 µg

Recombinant Human Arginase-1/ARG1 Protein, His Tag

Sign In for Pricing
View Details