Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUT7 Peptide - middle region

FUT7 Peptide - middle region

Product Specifications

Product Name Alternative

FucT-VII

UniProt

Q11130

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004470.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGRPLCASCLVPTVAQYRFYLSFENSQHRDYITEKFWRNALVAGTVPVVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pasteurella multocida Transaldolase B (talB)
MBS1281564-01 0.02 mg (E-Coli)

Recombinant Pasteurella multocida Transaldolase B (talB)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Transaldolase B (talB)
MBS1281564-02 0.02 mg (Yeast)

Recombinant Pasteurella multocida Transaldolase B (talB)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Transaldolase B (talB)
MBS1281564-03 0.1 mg (E-Coli)

Recombinant Pasteurella multocida Transaldolase B (talB)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Transaldolase B (talB)
MBS1281564-04 0.1 mg (Yeast)

Recombinant Pasteurella multocida Transaldolase B (talB)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Transaldolase B (talB)
MBS1281564-05 0.02 mg (Baculovirus)

Recombinant Pasteurella multocida Transaldolase B (talB)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Transaldolase B (talB)
MBS1281564-06 0.02 mg (Mammalian-Cell)

Recombinant Pasteurella multocida Transaldolase B (talB)

Sign In for Pricing
View Details