Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP15 Peptide - middle region

USP15 Peptide - middle region

Product Specifications

Product Name Alternative

UNPH4, UNPH-2

UniProt

Q9Y4E8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001239007.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX3 Mouse Monoclonal Antibody [Clone ID: OTI8G5]
CF811209 100 µg

TBX3 Mouse Monoclonal Antibody [Clone ID: OTI8G5]

Sign In for Pricing
View Details
ZFAND5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F2]
TA800486BM 100 µL

ZFAND5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F2]

Sign In for Pricing
View Details
Destriazolyl Bromo Propiconazole (Mixture of Diastereomers)
TRC-D297825-250MG 250 mg

Destriazolyl Bromo Propiconazole (Mixture of Diastereomers)

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS503636 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
2-Hydroxy-5-(1-hydroxyethyl)benzamide
TRC-H415055-1G 1 g

2-Hydroxy-5-(1-hydroxyethyl)benzamide

Sign In for Pricing
View Details
PSMD13 Recombinant Rabbit Monoclonal Antibody [PSH0-52]
HA721399 100 µL

PSMD13 Recombinant Rabbit Monoclonal Antibody [PSH0-52]

Sign In for Pricing
View Details