Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP15 Peptide - middle region

USP15 Peptide - middle region

Product Specifications

Product Name Alternative

UNPH4, UNPH-2

UniProt

Q9Y4E8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001239007.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EnzyChrom™ Glycolysis Assay Kit
ECGL-100 100 Tests

EnzyChrom™ Glycolysis Assay Kit

Sign In for Pricing
View Details
Cabazitaxel
TRC-C046500-5MG 5 mg

Cabazitaxel

Sign In for Pricing
View Details
Human UBFD1 activation kit by CRISPRa
GA111092 1 Kit

Human UBFD1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 5/6/18 (LP34), CF594 conjugate, 0.1mg/mL
BNC942036-500 1x 500 µL

Cytokeratin 5/6/18 (LP34), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAL3ST4 (NM_024637) Human Recombinant Protein
TP303401M 100 µg

GAL3ST4 (NM_024637) Human Recombinant Protein

Sign In for Pricing
View Details
GPR137 Human Gene Knockout Kit (CRISPR)
KN418962 1 Kit

GPR137 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details