Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPIN2 Peptide - middle region

LPIN2 Peptide - middle region

Product Specifications

UniProt

Q92539

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055461.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDSPSKKKGVHKRSQHQGPDDIYLDDLKGLEPEVAALYFPKSESEPGSRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2,3-Trichloronaphthalene
TRC-T798245-25MG 25 mg

1,2,3-Trichloronaphthalene

Sign In for Pricing
View Details
b-Benzyl L-Aspartic Acid N-carboxyanhydride
TRC-B230500-25G 25 g

b-Benzyl L-Aspartic Acid N-carboxyanhydride

Sign In for Pricing
View Details
STAT1 Recombinant Mouse monoclonal Antibody
HA610181 100 µg

STAT1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Human KRTAP4-9 activation kit by CRISPRa
GA119161 1 Kit

Human KRTAP4-9 activation kit by CRISPRa

Sign In for Pricing
View Details
7Alpha-Hydroxy Cholesterol
TRC-H917990-5MG 5 mg

7Alpha-Hydroxy Cholesterol

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS706288 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details