Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPIN2 Peptide - middle region

LPIN2 Peptide - middle region

Product Specifications

UniProt

Q92539

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055461.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDSPSKKKGVHKRSQHQGPDDIYLDDLKGLEPEVAALYFPKSESEPGSRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GDF-15 Recombinant Rabbit monoclonal Antibody
HA723807B 100 µL

Human GDF-15 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Integrin beta 4 (ITGB4) (NM_000213) Human Over-expression Lysate
LY424862 100 µg

Integrin beta 4 (ITGB4) (NM_000213) Human Over-expression Lysate

Sign In for Pricing
View Details
PAX5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A7]
TA801884BM 100 µL

PAX5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A7]

Sign In for Pricing
View Details
Cyclin D1 (DCS-6), CF405S conjugate, 0.1mg/mL
BNC040007-500 1x 500 µL

Cyclin D1 (DCS-6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TBC1D1 (NM_015173) Human Recombinant Protein
TP307980M 100 µg

TBC1D1 (NM_015173) Human Recombinant Protein

Sign In for Pricing
View Details
DR6 (TNFRSF21) (NM_014452) Human Over-expression Lysate
LY402336 100 µg

DR6 (TNFRSF21) (NM_014452) Human Over-expression Lysate

Sign In for Pricing
View Details