Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCN2 Peptide - middle region

CLCN2 Peptide - middle region

Product Specifications

Product Name Alternative

CLC2, ECA2, ECA3, EGI3, EGMA, EJM6, EJM8, CIC-2, EGI11, LKPAT, clC-2

UniProt

P51788

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001164558.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NAVAQSLQPSLYDSIIRIKKLPYLPELGWGRHQQYRVRVEDIMVRDVPHV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Indole-3-acetate
TRC-E919980-25G 25 g

Ethyl Indole-3-acetate

Sign In for Pricing
View Details
Otud6a Rabbit Polyclonal Antibody
TA379530 100 µL

Otud6a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant HIV-1 gp140 Protein (group M, subtype CRF07_BC) (His Tag)
PKSV030188 100 µg

Recombinant HIV-1 gp140 Protein (group M, subtype CRF07_BC) (His Tag)

Sign In for Pricing
View Details
FLIP (CFLAR) (NM_001127183) Human Over-expression Lysate
LY426693 100 µg

FLIP (CFLAR) (NM_001127183) Human Over-expression Lysate

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (IGA/1790R), CF568 conjugate, 0.1mg/mL
BNC681790-100 1x 100 µL

CD79a (B-Cell Marker) (IGA/1790R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DL-valine
TRC-V094195-500MG 500 mg

DL-valine

Sign In for Pricing
View Details