Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCN2 Peptide - middle region

CLCN2 Peptide - middle region

Product Specifications

Product Name Alternative

CLC2, ECA2, ECA3, EGI3, EGMA, EJM6, EJM8, CIC-2, EGI11, LKPAT, clC-2

UniProt

P51788

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001164558.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NAVAQSLQPSLYDSIIRIKKLPYLPELGWGRHQQYRVRVEDIMVRDVPHV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFYVE1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C2]
TA810182BM 100 µL

ZFYVE1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C2]

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF405S conjugate, 0.1mg/mL
BNC042702-500 1x 500 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gastrin (GAST/2633), CF647 conjugate, 0.1mg/mL
BNC472633-500 1x 500 µL

Gastrin (GAST/2633), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDC42 binding protein kinase alpha (CDC42BPA) Mouse Monoclonal Antibody [Clone ID: OTI12C12]
CF808221 100 µg

CDC42 binding protein kinase alpha (CDC42BPA) Mouse Monoclonal Antibody [Clone ID: OTI12C12]

Sign In for Pricing
View Details
Human MAPK15, N-Twin Strep, C-His, Flag Tag
HA210715-01 20 µg

Human MAPK15, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human MAPK15, N-Twin Strep, C-His, Flag Tag
HA210715-02 50 µg

Human MAPK15, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details