Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR6 Peptide - middle region

HTR6 Peptide - middle region

Product Specifications

Product Name Alternative

5-HT6, 5-HT6R

UniProt

P50406

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000862.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VANIVQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAV2(Rep78, 68, 52, 40) Rabbit Monoclonal Antibody [Clone ID: OTIR3A10]
TA594439S 30 µL

AAV2(Rep78, 68, 52, 40) Rabbit Monoclonal Antibody [Clone ID: OTIR3A10]

Sign In for Pricing
View Details
XAV939
SIH-532-25MG 25 mg

XAV939

Sign In for Pricing
View Details
MAP1LC3A Human Gene Knockout Kit (CRISPR)
KN402222 1 Kit

MAP1LC3A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL
BNC681387-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4,4'-Diaminostilbene
TRC-D416848-1G 1 g

4,4'-Diaminostilbene

Sign In for Pricing
View Details
MTX1 (NM_198883) Human Recombinant Protein
TP762068 50 µg

MTX1 (NM_198883) Human Recombinant Protein

Sign In for Pricing
View Details