Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR6 Peptide - middle region

HTR6 Peptide - middle region

Product Specifications

Product Name Alternative

5-HT6, 5-HT6R

UniProt

P50406

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000862.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VANIVQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109F-01 20 Tests

PerCP Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
PerCP Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109F-02 100 Tests

PerCP Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
PerCP Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109F-03 2x 100 Tests

PerCP Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR560001 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF594 conjugate, 0.1mg/mL
BNC941203-100 1x 100 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMSH (STAMBP) (C-term) Rabbit Polyclonal Antibody
AP54063PU-N 400 µL

AMSH (STAMBP) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details