Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRHPR Peptide - middle region

GRHPR Peptide - middle region

Product Specifications

Product Name Alternative

PH2, GLXR, GLYD

UniProt

Q9UBQ7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036335.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IKB alpha Rabbit pAb
GB111509 100 μL

Anti-IKB alpha Rabbit pAb

Sign In for Pricing
View Details
3- (Salicyloylamino) -1,2,4-triazole
sc-352321 1 g

3- (Salicyloylamino) -1,2,4-triazole

Sign In for Pricing
View Details
Recombinant Human JADE1 Protein, N-His
YHN27601 100 μg

Recombinant Human JADE1 Protein, N-His

Sign In for Pricing
View Details
Methyl 2-amino-3-methylpyridine-4-carboxylate
DKB80478-01 50 mg

Methyl 2-amino-3-methylpyridine-4-carboxylate

Sign In for Pricing
View Details
Methyl 2-amino-3-methylpyridine-4-carboxylate
DKB80478-02 0.5 g

Methyl 2-amino-3-methylpyridine-4-carboxylate

Sign In for Pricing
View Details
Wif1 (BC004048) Mouse Recombinant Protein
PM48145M5 20 µg

Wif1 (BC004048) Mouse Recombinant Protein

Sign In for Pricing
View Details