What is the catalog number for GRHPR Peptide - middle region?

The catalog number for GRHPR Peptide - middle region is orb1998795.

What sizes are available for GRHPR Peptide - middle region?

GRHPR Peptide - middle region is available in the following size(s): 100 µg.

Is GRHPR Peptide - middle region in stock?

GRHPR Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GRHPR Peptide - middle region

Product Specifications

Product Name Alternative

PH2, GLXR, GLYD

UniProt

Q9UBQ7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036335.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PH318348 10 µg

DUX5 (NM_012149) Human Mass Spec Standard

Sign In for Pricing

View Details

orb2128461 100 µL

BATF Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing

View Details

sc-421579-ACT-2 20 µg

MBD4 CRISPR Activation Plasmid (m2)

Sign In for Pricing

View Details

ORF067854 1.0 µg DNA

Gramd1b ORF Vector (Rat) (pORF)

Sign In for Pricing

View Details

K4925007 1.0 µg DNA

Spata24 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing

View Details

AMM17903V 100 µL

LIME (LIME1) Mouse Monoclonal Antibody [Clone ID: LBI3B10]

Sign In for Pricing

View Details