Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BYSL Peptide - middle region

BYSL Peptide - middle region

Product Specifications

Product Name Alternative

BYSTIN

UniProt

Q13895

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004044.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAAPRERTTRLGPRMPQDGSDDEDEEWPTLEKAATMTAAGHHAEVVVDPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Rabbit Polyclonal Antibody
TA325321 100 µL

CD19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PHKG2 antibody
70R-2669 100 µL

PHKG2 antibody

Sign In for Pricing
View Details
BTG1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV673684 1.0 µg DNA

BTG1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Methylthioribulose-1-phosphate dehydratase (mtnB)
RPC30491-01 20 µg

Recombinant Synechococcus sp. Methylthioribulose-1-phosphate dehydratase (mtnB)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Methylthioribulose-1-phosphate dehydratase (mtnB)
RPC30491-02 100 µg

Recombinant Synechococcus sp. Methylthioribulose-1-phosphate dehydratase (mtnB)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Methylthioribulose-1-phosphate dehydratase (mtnB)
RPC30491-03 1 mg

Recombinant Synechococcus sp. Methylthioribulose-1-phosphate dehydratase (mtnB)

Sign In for Pricing
View Details