What is the catalog number for BYSL Peptide - middle region?

The catalog number for BYSL Peptide - middle region is orb1998794.

What sizes are available for BYSL Peptide - middle region?

BYSL Peptide - middle region is available in the following size(s): 100 µg.

Is BYSL Peptide - middle region in stock?

BYSL Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

BYSL Peptide - middle region

Product Specifications

Product Name Alternative

BYSTIN

UniProt

Q13895

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004044.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAAPRERTTRLGPRMPQDGSDDEDEEWPTLEKAATMTAAGHHAEVVVDPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GWB-71200D 0.1 mg

EPM2AIP1 Over-expression Lysate Product

Sign In for Pricing

View Details

CBP3141-01 1 mg

BAD (pS136) Blocking Peptide

Sign In for Pricing

View Details

CBP3141-02 5 mg

BAD (pS136) Blocking Peptide

Sign In for Pricing

View Details

NBP2-98533MFV500 0.1 mL

Rabbit Polyclonal NSMCE1 Antibody [mFluor Violet 500 SE]

Sign In for Pricing

View Details

LS001736-20ug 20 µg

DKC1 (NM_001363) Human Over-expression Lysate

Sign In for Pricing

View Details

PRTN16-N-1 1 mg

Bovine Prothrombin (Factor II) (>95%) for ELISA

Sign In for Pricing

View Details