Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BYSL Peptide - C-terminal region

BYSL Peptide - C-terminal region

Product Specifications

Product Name Alternative

BYSTIN

UniProt

Q13895

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004044.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNS1 Antibody
GWB-MU739A 50 µg

MNS1 Antibody

Sign In for Pricing
View Details
Accn2 AAV siRNA Pooled Vector
11159164 1.0 µg

Accn2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
KATNA1 Antibody
DF8027-01 100 µL

KATNA1 Antibody

Sign In for Pricing
View Details
KATNA1 Antibody
DF8027-02 200 µL

KATNA1 Antibody

Sign In for Pricing
View Details
Antioxidant 245
HY-136779-01 100 g

Antioxidant 245

Sign In for Pricing
View Details
Antioxidant 245
HY-136779-02 500 g

Antioxidant 245

Sign In for Pricing
View Details