Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BYSL Peptide - C-terminal region

BYSL Peptide - C-terminal region

Product Specifications

Product Name Alternative

BYSTIN

UniProt

Q13895

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004044.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine neuromedin U (NMU) ELISA Kit
MBS283481-01 48 Tests

Canine neuromedin U (NMU) ELISA Kit

Sign In for Pricing
View Details
Canine neuromedin U (NMU) ELISA Kit
MBS283481-02 96 Tests

Canine neuromedin U (NMU) ELISA Kit

Sign In for Pricing
View Details
Canine neuromedin U (NMU) ELISA Kit
MBS283481-03 5x 96 Tests

Canine neuromedin U (NMU) ELISA Kit

Sign In for Pricing
View Details
Canine neuromedin U (NMU) ELISA Kit
MBS283481-04 10x 96 Tests

Canine neuromedin U (NMU) ELISA Kit

Sign In for Pricing
View Details
Pipette Filter tips, 0.2-10 uL, Low Retention, Refill Natural, Sterile, DNase/RNase free - 10 x 96 un. - ABDOS
P11082 1 Each

Pipette Filter tips, 0.2-10 uL, Low Retention, Refill Natural, Sterile, DNase/RNase free - 10 x 96 un. - ABDOS

Sign In for Pricing
View Details
RBL1, Phosphorylated (Ser975) (RB-like 1, Retinoblastoma-like Protein 1, 107kD Retinoblastoma-associated Protein, PRB1, P107) (APC)
MBS6497042-01 0.2 mL

RBL1, Phosphorylated (Ser975) (RB-like 1, Retinoblastoma-like Protein 1, 107kD Retinoblastoma-associated Protein, PRB1, P107) (APC)

Sign In for Pricing
View Details