Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST3 Peptide - C-terminal region

CHST3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSD, C6ST, C6ST1

UniProt

Q7LGC8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004264.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAT1 HDR Plasmid (m)
sc-424158-HDR 20 µg

VAT1 HDR Plasmid (m)

Sign In for Pricing
View Details
Mouse Pon3 ELISA Kit
EF015793 96 Tests

Mouse Pon3 ELISA Kit

Sign In for Pricing
View Details
Padi4 Mouse qPCR Primer Pair (NM_011061)
MP210688 200 Reactions

Padi4 Mouse qPCR Primer Pair (NM_011061)

Sign In for Pricing
View Details
PARN Rabbit pAb
APA4087-01 30 µL

PARN Rabbit pAb

Sign In for Pricing
View Details
PARN Rabbit pAb
APA4087-02 50 μL

PARN Rabbit pAb

Sign In for Pricing
View Details
PARN Rabbit pAb
APA4087-03 100 µL

PARN Rabbit pAb

Sign In for Pricing
View Details