Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST3 Peptide - C-terminal region

CHST3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSD, C6ST, C6ST1

UniProt

Q7LGC8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004264.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rad17 shRNA (UAS) - Lentiviral mouse Rad17 shRNA (UAS) plasmid
GTR15258751 1 Vial

Lentiviral mouse Rad17 shRNA (UAS) - Lentiviral mouse Rad17 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Kcnj4 siRNA Oligos set (Mouse)
25385174 3x 5 nmol

Kcnj4 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
P130 Cas (phospho Tyr410) Rabbit Polyclonal Antibody
APRab05143-01 20 µL

P130 Cas (phospho Tyr410) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P130 Cas (phospho Tyr410) Rabbit Polyclonal Antibody
APRab05143-02 50 µL

P130 Cas (phospho Tyr410) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P130 Cas (phospho Tyr410) Rabbit Polyclonal Antibody
APRab05143-03 100 µL

P130 Cas (phospho Tyr410) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P130 Cas (phospho Tyr410) Rabbit Polyclonal Antibody
APRab05143-04 200 µL

P130 Cas (phospho Tyr410) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details