What is the catalog number for RNF216 Peptide - middle region?

The catalog number for RNF216 Peptide - middle region is orb1998791.

What sizes are available for RNF216 Peptide - middle region?

RNF216 Peptide - middle region is available in the following size(s): 100 µg.

Is RNF216 Peptide - middle region in stock?

RNF216 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RNF216 Peptide - middle region

Product Specifications

Product Name Alternative

ZIN, CAHH, U7I1, TRIAD3, UBCE7IP1

UniProt

Q9NWF9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_996994.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPPLEKPVEKVQRVEALPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-81280H 0.1 mL

Mouse Monoclonal LSM2 Antibody (1G7) [HRP]

Sign In for Pricing

View Details

NSL2027Hu 96 Tests

Human haemagglutinin (HA) ELISA Kit

Sign In for Pricing

View Details

bsm-62686R-01 20 µL

USO1 Recombinant Antibody

Sign In for Pricing

View Details

bsm-62686R-02 100 µL

USO1 Recombinant Antibody

Sign In for Pricing

View Details

TA398124 500 µg

F(ab')2 Dog IgG (H&L) Antibody Phycoerythrin conjugated

Sign In for Pricing

View Details

463954-01 1 mg

(R) -Doxazosin-d8

Sign In for Pricing

View Details