What is the catalog number for RNF216 Peptide - middle region?

The catalog number for RNF216 Peptide - middle region is orb1998791.

What sizes are available for RNF216 Peptide - middle region?

RNF216 Peptide - middle region is available in the following size(s): 100 µg.

Is RNF216 Peptide - middle region in stock?

RNF216 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RNF216 Peptide - middle region

Product Specifications

Product Name Alternative

ZIN, CAHH, U7I1, TRIAD3, UBCE7IP1

UniProt

Q9NWF9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_996994.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPPLEKPVEKVQRVEALPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCP1568-01 1 mg

[Ala1]-PAR-4 (1-6) (Mouse)

Sign In for Pricing

View Details

CCP1568-02 5 mg

[Ala1]-PAR-4 (1-6) (Mouse)

Sign In for Pricing

View Details

CCP1568-03 10 mg

[Ala1]-PAR-4 (1-6) (Mouse)

Sign In for Pricing

View Details

BZ35661 1 Vial

PGPU6-FBXW11 (human) -shRNA4-EnCMV-EGFP-SV40-Neo

Sign In for Pricing

View Details

MBS6422440-01 0.1 mL

IL18R1 (Interleukin 18 Receptor 1, CD218a, IL18RA, IL1RRP, CDw218a, IL-1Rrp) (FITC)

Sign In for Pricing

View Details

MBS6422440-02 5x 0.1 mL

IL18R1 (Interleukin 18 Receptor 1, CD218a, IL18RA, IL1RRP, CDw218a, IL-1Rrp) (FITC)

Sign In for Pricing

View Details