VIL1 Peptide - middle region
VIL1 Peptide - middle region
Product Specifications
Product Name Alternative
VIL, D2S1471
UniProt
P09327
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_009058.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWTASNRTSGLGKTHTVGSV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-61668R-HRP-TR 20 µL
Factor IX Recombinant Antibody, HRP Conjugated
Sign In for Pricing
View Details 
MBS6272323-01 0.2 mL
AGTRAP, CT (AGTRAP, ATRAP, Type-1 angiotensin II receptor-associated protein, AT1 receptor-associated protein) (APC)
Sign In for Pricing
View Details MBS6272323-02 5x 0.2 mL
AGTRAP, CT (AGTRAP, ATRAP, Type-1 angiotensin II receptor-associated protein, AT1 receptor-associated protein) (APC)
Sign In for Pricing
View Details 
HP209405 200 Reactions
MAP126 (SPAG5) Human qPCR Primer Pair (NM_006461)
Sign In for Pricing
View Details