Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIL1 Peptide - middle region

VIL1 Peptide - middle region

Product Specifications

Product Name Alternative

VIL, D2S1471

UniProt

P09327

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009058.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWTASNRTSGLGKTHTVGSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PSMA (N-6His)
C03W-50ug 50 µg

Recombinant Mouse PSMA (N-6His)

Sign In for Pricing
View Details
Bifenazate (Standard)
HY-119687R-01 10 mg

Bifenazate (Standard)

Sign In for Pricing
View Details
Bifenazate (Standard)
HY-119687R-02 25 mg

Bifenazate (Standard)

Sign In for Pricing
View Details
Bifenazate (Standard)
HY-119687R-03 50 mg

Bifenazate (Standard)

Sign In for Pricing
View Details
Bifenazate (Standard)
HY-119687R-04 100 mg

Bifenazate (Standard)

Sign In for Pricing
View Details
Recombinant Rickettsia massiliae Ferredoxin--NADP reductase (RMA_0647)
MBS1093303-01 0.02 mg (E-Coli)

Recombinant Rickettsia massiliae Ferredoxin--NADP reductase (RMA_0647)

Sign In for Pricing
View Details