Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA11 Peptide - middle region

ANXA11 Peptide - middle region

Product Specifications

Product Name Alternative

ANX11, CAP50

UniProt

P50995

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001148.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL6-set siRNA/shRNA/RNAi Lentivector (Human)
12397091 4x 500 ng

ARL6-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
RBM15 (RNA-binding Motif Protein 15, Putative RNA-binding Protein 15, One-twenty Two Protein 1, OTT1, OTT, SPEN) (FITC)
MBS6149261-01 0.1 mL

RBM15 (RNA-binding Motif Protein 15, Putative RNA-binding Protein 15, One-twenty Two Protein 1, OTT1, OTT, SPEN) (FITC)

Sign In for Pricing
View Details
RBM15 (RNA-binding Motif Protein 15, Putative RNA-binding Protein 15, One-twenty Two Protein 1, OTT1, OTT, SPEN) (FITC)
MBS6149261-02 5x 0.1 mL

RBM15 (RNA-binding Motif Protein 15, Putative RNA-binding Protein 15, One-twenty Two Protein 1, OTT1, OTT, SPEN) (FITC)

Sign In for Pricing
View Details
Guinea Pig Neuritin ELISA Kit
GTR10314914 96 Well

Guinea Pig Neuritin ELISA Kit

Sign In for Pricing
View Details
SKP1 Antibody (FITC)
orb350706-01 50 µg

SKP1 Antibody (FITC)

Sign In for Pricing
View Details
SKP1 Antibody (FITC)
orb350706-02 100 µg

SKP1 Antibody (FITC)

Sign In for Pricing
View Details