Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA11 Peptide - middle region

ANXA11 Peptide - middle region

Product Specifications

Product Name Alternative

ANX11, CAP50

UniProt

P50995

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001148.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE anti-Chicken CD4
FC1230 100 Tests

PE anti-Chicken CD4

Sign In for Pricing
View Details
FANCD2 polyclonal antibody
orb646585-01 50 μL

FANCD2 polyclonal antibody

Sign In for Pricing
View Details
FANCD2 polyclonal antibody
orb646585-02 100 µL

FANCD2 polyclonal antibody

Sign In for Pricing
View Details
FANCD2 polyclonal antibody
orb646585-03 200 µL

FANCD2 polyclonal antibody

Sign In for Pricing
View Details
Mouse ADAM10 Ectodomain Polyclonal Ab
AB946 1 mg

Mouse ADAM10 Ectodomain Polyclonal Ab

Sign In for Pricing
View Details
ZNF230 (NM_006300) Human Tagged ORF Clone Lentiviral Particle
RC208201L3V 200 µL

ZNF230 (NM_006300) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details