What is the catalog number for ANXA11 Peptide - middle region?

The catalog number for ANXA11 Peptide - middle region is orb1998789.

What sizes are available for ANXA11 Peptide - middle region?

ANXA11 Peptide - middle region is available in the following size(s): 100 µg.

Is ANXA11 Peptide - middle region in stock?

ANXA11 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ANXA11 Peptide - middle region

Product Specifications

Product Name Alternative

ANX11, CAP50

UniProt

P50995

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001148.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS9230741-01 0.5 mg

ARHGEF7 Blocking Peptide (C-Term)

Sign In for Pricing

View Details

MBS9230741-02 5x 0.5 mg

ARHGEF7 Blocking Peptide (C-Term)

Sign In for Pricing

View Details

bs-16616R-PE-Cy7 100 µL

Integrin linked ILK Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing

View Details

orb402667 96 Tests

Mouse Cardiotrophin-1 / CT-1 ELISA Kit

Sign In for Pricing

View Details

K3799401 3x 1.0 µg

Wnt2b sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing

View Details

orb2612789 100 µg

Synaptotagmin 1/SYT1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing

View Details