Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA11 Peptide - middle region

ANXA11 Peptide - middle region

Product Specifications

Product Name Alternative

ANX11, CAP50

UniProt

P50995

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001148.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRN3 siRNA (Rat)
MBS8216098-01 15 nmol

LRRN3 siRNA (Rat)

Sign In for Pricing
View Details
LRRN3 siRNA (Rat)
MBS8216098-02 30 nmol

LRRN3 siRNA (Rat)

Sign In for Pricing
View Details
LRRN3 siRNA (Rat)
MBS8216098-03 5x 30 nmol

LRRN3 siRNA (Rat)

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H&L) - AP
CSA2811-01 100 µL

Goat Anti-Rabbit IgG (H&L) - AP

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H&L) - AP
CSA2811-02 500 μL

Goat Anti-Rabbit IgG (H&L) - AP

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H&L) - AP
CSA2811-03 1 mL

Goat Anti-Rabbit IgG (H&L) - AP

Sign In for Pricing
View Details