ANXA11 Peptide - middle region
ANXA11 Peptide - middle region
Product Specifications
Product Name Alternative
ANX11, CAP50
UniProt
P50995
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001148.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E33P101578 10 µg
Human DLL3 (27-175) Protein, N-MBP Tag and C-10xHis tag
Sign In for Pricing
View Details 
MBS668272-01 0.025 mg
Monoclonal Antibody to 14-3-3 Theta (Clone: ABM52H6)
Sign In for Pricing
View Details MBS668272-02 0.1 mg
Monoclonal Antibody to 14-3-3 Theta (Clone: ABM52H6)
Sign In for Pricing
View Details MBS668272-03 5x 0.1 mg
Monoclonal Antibody to 14-3-3 Theta (Clone: ABM52H6)
Sign In for Pricing
View Details