Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA11 Peptide - middle region

ANXA11 Peptide - middle region

Product Specifications

Product Name Alternative

ANX11, CAP50

UniProt

P50995

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001148.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Proteinase 3 (PR3) ELISA Kit
RDR-PR3-Ra-48Tests 48 Tests

Rat Proteinase 3 (PR3) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 19 Antibody (KRT19/799 + KRT19/800) - Azide and BSA Free
NBP2-47948-0.1mg 0.1 mg

Mouse Monoclonal Cytokeratin 19 Antibody (KRT19/799 + KRT19/800) - Azide and BSA Free

Sign In for Pricing
View Details
CD8-α siRNA (h2)
sc-35028 10 µM

CD8-α siRNA (h2)

Sign In for Pricing
View Details
CDKN1A Blocking peptide
orb1442762 500 µg

CDKN1A Blocking peptide

Sign In for Pricing
View Details
Rabbit Monoclonal RIPK3/RIP3 Antibody (1312A) [Alexa Fluor 594]
NBP2-76800AF594 0.1 mL

Rabbit Monoclonal RIPK3/RIP3 Antibody (1312A) [Alexa Fluor 594]

Sign In for Pricing
View Details
Human SEC14L5 qPCR Primer Pair
QH29377S 200 Tests

Human SEC14L5 qPCR Primer Pair

Sign In for Pricing
View Details