Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR7A2 Peptide - middle region

AKR7A2 Peptide - middle region

Product Specifications

Product Name Alternative

AFAR, AKR7, AFAR1, AFB1-AR1

UniProt

Q8NHP1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003680.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grip2 3'UTR Lenti-reporter-Luc Vector
22681086 1.0 µg

Grip2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
S1pr5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3750105 3x 1.0 µg

S1pr5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
APAF1 (CT) Polyclonal Antibody, PE Conjugated
bs-0058R-PE-TR 20 µL

APAF1 (CT) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Human ISG20L2 siRNA
abx902712-01 15 nmol

Human ISG20L2 siRNA

Sign In for Pricing
View Details
Human ISG20L2 siRNA
abx902712-02 30 nmol

Human ISG20L2 siRNA

Sign In for Pricing
View Details
DiagAg™ SP Agarose Particles, 6% Crosslinked, 20-50 μm
DAG-24PA30-H 25 mL

DiagAg™ SP Agarose Particles, 6% Crosslinked, 20-50 μm

Sign In for Pricing
View Details