Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR12 Peptide - N-terminal region

GPR12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPCR12, GPCR21, PPP1R84

UniProt

P47775

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005279.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P57 / KIP2 (KP10 + KIP2/880), CF647 conjugate, 0.1mg/mL
BNC471015-500 1x 500 µL

P57 / KIP2 (KP10 + KIP2/880), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Accuris™ Smart-Q™ 100 Fluorometer for single samples, 230V
F1001-E 1 Each

Accuris™ Smart-Q™ 100 Fluorometer for single samples, 230V

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), 1mg/mL
BNUM2047-50 1x 50 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), 1mg/mL

Sign In for Pricing
View Details
Tefm Mouse Gene Knockout Kit (CRISPR)
KN517396 1 Kit

Tefm Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Copper Hexafluorosilicate Hydrate
TRC-C990315-5G 5 g

Copper Hexafluorosilicate Hydrate

Sign In for Pricing
View Details
Hoxc4 Rabbit Polyclonal Antibody
TA363190 100 µL

Hoxc4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details