Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR12 Peptide - N-terminal region

GPR12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPCR12, GPCR21, PPP1R84

UniProt

P47775

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005279.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biocidal ZF
WAK-ZF-1 1 L

Biocidal ZF

Sign In for Pricing
View Details
6-Fluoroquinoline-8-carboxylic Acid (~90%)
TRC-B438558-50MG 50 mg

6-Fluoroquinoline-8-carboxylic Acid (~90%)

Sign In for Pricing
View Details
GTPBP9 (OLA1) (NM_013341) Human Over-expression Lysate
LY402245 100 µg

GTPBP9 (OLA1) (NM_013341) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SCHIP1 activation kit by CRISPRa
GA109351 1 Kit

Human SCHIP1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (rIGA/764), CF568 conjugate, 0.1mg/mL
BNC681862-500 1x 500 µL

CD79a (B-Cell Marker) (rIGA/764), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Calmodulin/CALM1 Protein
PKSH032148-01 10 µg

Recombinant Human Calmodulin/CALM1 Protein

Sign In for Pricing
View Details