CANX Peptide - middle region

Product Specifications

Product Name Alternative

CNX, P90, IP90

UniProt

P27824

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001019820.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKI

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIA07628Gu 1 Kit

Guinea pig gp130 soluble fragment ELISA KIT

View Details

orb1280670 100 µL

GRK3 Antibody

View Details

TL502295 1 Kit

Tlr4 Mouse shRNA Plasmid (Locus ID 21898)

View Details

E45M21998V-2 50 µL

CDX2 Mouse Monoclonal Antibody [Clone U mLBI265]

View Details

E45M43320M5 20 µg

Srl (NM_175347) Mouse Recombinant Protein

View Details

bsm-61469R-BF680-TR 20 µL

PML Recombinant Antibody, AbBy Fluor™ 680 Conjugated

View Details